DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP013252

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003436670.1 Gene:AgaP_AGAP013252 / 11175997 VectorBaseID:AGAP013252 Length:597 Species:Anopheles gambiae


Alignment Length:243 Identity:59/243 - (24%)
Similarity:101/243 - (41%) Gaps:25/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GIKAKQGQFPHQISLRLRG----EHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            |.:.|:|.:|...::..|.    |:.|||.|:....::||.||:.....::..|..|:|.|...|
Mosquito    48 GTETKEGHWPWHTAIYHREQTNFEYVCGGSILDRNTILTAAHCLYTSRGLIKLDQLSVQVGRNQL 112

  Fly   101 SSDGVRIP---VAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAV---- 157
            |...||..   ..::|:||.::... .:|:|:::|.:.:|....:..:.|.:.:|...:.|    
Mosquito   113 SEASVRSQEHHPEQLIVHPGFSPNSVTDDIALIKLATDITMTRYVQPVCLWSLEPNLDLIVGRNG 177

  Fly   158 DISGWGNIAEKGPLSDSLLFVQVTSISRGAC----RWMFYSRLPETMICLLHSKNSGACYGDSG- 217
            .:.|:| :.|...:||.|....:..:....|    |.::...|...|.|.........|.|||| 
Mosquito   178 TVVGFG-LTEHDRVSDYLRQAAIAVVDSWTCIESDRQVYGVTLTANMYCGGGKTGVSVCNGDSGG 241

  Fly   218 ------GPATYGGKVVGLASLLLGGG-CGRAAPDGYLRISKVRAWIAE 258
                  |...|...||....|....| |.......:..::|.|.||.:
Mosquito   242 GMFFEHGDTWYVRGVVSFMPLRENVGLCDGTKYTVFTDVAKYRDWIGQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 57/239 (24%)
Tryp_SPc 37..219 CDD:238113 48/201 (24%)
AgaP_AGAP013252XP_003436670.1 Tryp_SPc 47..287 CDD:214473 57/239 (24%)
Tryp_SPc 48..287 CDD:238113 57/239 (24%)
Tryp_SPc 334..575 CDD:214473
Tryp_SPc 335..575 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.