DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Ctrl

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:268 Identity:91/268 - (33%)
Similarity:132/268 - (49%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLL-----CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR-LRGEHYCGGV 65
            |:.|:||     |||..|. ..::.||       |||.|..|..|.:|.|:||: ..|.|:|||.
Mouse     7 TLSLVLLGSSWGCGVPAIT-PALSYNQ-------RIVNGENAVPGSWPWQVSLQDNTGFHFCGGS 63

  Fly    66 IISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPV---AEVIMHPNY-ATGGHNDL 126
            :||...|:||.||     .|.|...: :..|....||:...:.|   |..|.|||: |...:|||
Mouse    64 LISPNWVVTAAHC-----QVTPGRHF-VVLGEYDRSSNAEPVQVLSIARAITHPNWNANTMNNDL 122

  Fly   127 AVLRLQSPLTFDANIAAIQLAT--EDPPNCVAVDISGWGNIAEKGPLSDS-LLFVQVTSISRGAC 188
            .:|:|.||..:.|.::.:.||:  |..|:.:....:|||.|:..|.::.: |..|.:..::...|
Mouse   123 TLLKLASPARYTAQVSPVCLASTNEALPSGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQC 187

  Fly   189 RWMFYSRLPETMICLLHSKNSGA--CYGDSGGP-ATYGGKVVGLASLLLGG--GCGRAAPDGYLR 248
            |..:.:|:.:.|||   :..|||  |.|||||| ....|....|..::..|  .|...||..|.|
Mouse   188 RQYWGARITDAMIC---AGGSGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNIQAPAMYTR 249

  Fly   249 ISKVRAWI 256
            :||...||
Mouse   250 VSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/232 (34%)
Tryp_SPc 37..219 CDD:238113 66/191 (35%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 79/232 (34%)
Tryp_SPc 34..260 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.