DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC108647852

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:283 Identity:76/283 - (26%)
Similarity:123/283 - (43%) Gaps:57/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR-LRGEHY---CGGVIISAT 70
            :|..||::.::       ::...:. |::.|...:.|.:|...|:: |..:.|   ||||::|..
 Frog    25 ILKTCGIRPLV-------KNHHRVR-RVIEGNTPEPGSWPWMASIQLLYKDGYGSACGGVLLSNR 81

  Fly    71 HVITAGHCV------KHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEV---IMHPNYATGGH-ND 125
            .|:||.||:      :|        |..|..|:..|:..|....:..:   |.|.::....| ||
 Frog    82 WVVTAAHCLSDLKRYRH--------LARIVLGARDLTQLGPETQIRTIKQWIQHEDFDHKTHKND 138

  Fly   126 LAVLRLQSPLTFDANIAAIQLATEDPP---NCVAVD---ISGWGNIAEKGPLSDSLLFVQVT--S 182
            :|::||..|:.|...|....|    ||   |...:|   |:|||.:.|| |.:.:.:..:.|  .
 Frog   139 IALIRLNYPVKFSDYIQPACL----PPKSSNVYKMDDCHIAGWGLLNEK-PRTVTTMLQEATVEL 198

  Fly   183 ISRGACR---WMFYSRLPETMICLLHSKNS-GACYGDSGGPATYGGK------VVGLASLLLGGG 237
            |.|..|.   | :...:.:..:|..:.:.. ..|.||||||.....|      |||:.|  .||.
 Frog   199 IDRKRCNSSDW-YNGGIHDDNLCAGYEQGGPDVCMGDSGGPLMCKRKKAGIYYVVGIVS--WGGL 260

  Fly   238 CGRAAPDG-YLRISKVRAWIAEK 259
            ||:...:| |..:.....||..|
 Frog   261 CGQPHSNGVYTSVQDFEQWIFNK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/252 (28%)
Tryp_SPc 37..219 CDD:238113 56/207 (27%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.