DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:270 Identity:76/270 - (28%)
Similarity:112/270 - (41%) Gaps:54/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGH 77
            :||:       :..|.|...     |||..:....:|.|.||.......|||.:|:...|::|.|
Zfish   296 VCGI-------IPVNSSNGT-----VGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAH 348

  Fly    78 CVKHGNDVVPADLWSIQAGSLLLS----------SDGVRI--PVAEVIMHPNY-ATGGHNDLAVL 129
            |            ::.|.....|:          .|..||  .|..||.||.| .....||:|::
Zfish   349 C------------FNGQRNGFYLTVILGPKTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALV 401

  Fly   130 RLQSPLTFDANIAAIQLATE------DPPNCVAVDISGWGNIAEKGPLSDSLLF--VQVTSISRG 186
            ||..|:||..:|..:.||.|      |..:.    |:.|.||::..||....:|  |:|..|...
Zfish   402 RLSFPITFTDSIRPVCLAAEGSVFNSDTESW----ITTWRNISDGVPLPSPKIFQEVEVPVIGNR 462

  Fly   187 ACRWMF-YSRLPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLAS--LLLGGGCGRAA-PDGY 246
            .|..:: ...:.:.|||. |..:....|.||||||.......|.:.|  :..|.||.::. |..|
Zfish   463 QCNCLYGVGSITDNMICAGLLKEGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGSGCAQSEFPGVY 527

  Fly   247 LRISKVRAWI 256
            .|:|:.:.||
Zfish   528 TRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/245 (29%)
Tryp_SPc 37..219 CDD:238113 59/204 (29%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 70/243 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.