DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Try5

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:240 Identity:69/240 - (28%)
Similarity:113/240 - (47%) Gaps:34/240 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK---------HGNDVVPAD 89
            :.:||||...::...|:|:||. .|.|:|||.:|:...|::|.||.|         |..:|:..:
  Rat    21 DDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGN 84

  Fly    90 LWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPN 153
            ...:.|              |::|.|||: |...:||:.:::|..|:|.::.:|.:.|.:...|.
  Rat    85 EQFVNA--------------AKIIKHPNFNARNLNNDIMLIKLSVPVTLNSRVATVALPSSCAPA 135

  Fly   154 CVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMFYSRLPETMIC---LLHSKNSGACYG 214
            .....||||||....|..:..|| .:....:.:..|...:..::...|||   |...|:|  |.|
  Rat   136 GTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNMICVGFLEGGKDS--CQG 198

  Fly   215 DSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAE 258
            |||||....|::.|:.|  .|.||. :..|..|.::.....||.:
  Rat   199 DSGGPVVCNGQLQGIVS--WGYGCALKDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/234 (29%)
Tryp_SPc 37..219 CDD:238113 57/195 (29%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 67/234 (29%)
Tryp_SPc 24..242 CDD:238113 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.