DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk15

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:269 Identity:57/269 - (21%)
Similarity:81/269 - (30%) Gaps:120/269 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLC--GVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCG 63
            ||..|..:||:...  |.:|:.|::...:..                   |.|::|..||...||
  Rat     1 MWLLLAFILLVSAAQDGDKVLEGEECVPHSQ-------------------PWQVALFERGRFNCG 46

  Fly    64 GVIISATHVITAGHC------VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG 122
            ..:||...|:||.||      |:.|..    :|........|.|       |:.:|.||.|....
  Rat    47 AFLISPHWVLTAAHCQTRFMRVRLGEH----NLRKFDGPEQLRS-------VSRIIPHPGYEART 100

  Fly   123 H-NDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRG 186
            | :|:.:|||..|                                                    
  Rat   101 HRHDIMLLRLFRP---------------------------------------------------- 113

  Fly   187 ACRWMFYSRL-PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG--CGRAAPDG-YL 247
                   :|| |:               ||||||...||.:.|:.|   .|.  |......| |.
  Rat   114 -------ARLTPQ---------------GDSGGPLVCGGALQGIVS---WGDVPCDTTTKPGVYT 153

  Fly   248 RISKVRAWI 256
            ::.....||
  Rat   154 KVCSYMDWI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 47/230 (20%)
Tryp_SPc 37..219 CDD:238113 37/189 (20%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 50/247 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.