DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:266 Identity:83/266 - (31%)
Similarity:124/266 - (46%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQIS-LRLRGE--HYCGGVIISAT 70
            |..:.||:             .:.::.|||||..|..|.:|.|:. |:|.|.  :.|||.||:..
 Frog   250 LRCISCGL-------------STKVDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPH 301

  Fly    71 HVITAGHCVKHGNDVVPADLWSIQAGSLLLSS-DGVRIPVAEVIMHPNYATGGH-NDLAVLRLQS 133
            .::||.||| :|:...|: .:.:.||||.:.| ......|...::||:|::... .|:|:|:|.:
 Frog   302 WIVTAAHCV-YGSTSTPS-AFKVFAGSLTIQSYYSAGYTVERALVHPSYSSYTQIYDVALLKLTA 364

  Fly   134 PLTFDANIAAIQLATEDPP-----NCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRW--M 191
            .|.|..|:..:.|.....|     .|.   |||||..||.|.:|.:|:...|..||...|..  :
 Frog   365 ALVFTTNLRPVCLPNVGMPWAEGQPCW---ISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAV 426

  Fly   192 FYSRLPETMICLLH-SKNSGACYGDSGGPATYGGK----VVGLASLLLGGGCGRA-APDGYLRIS 250
            :...:..||:|..: |..:..|.||||||......    :||..|  .|.||.|| .|..|..::
 Frog   427 YGGAISSTMMCAGYLSGGTDTCQGDSGGPLVTKTNSLWWLVGDTS--WGYGCARAYKPGVYGNVT 489

  Fly   251 KVRAWI 256
            ....||
 Frog   490 VFIEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 78/237 (33%)
Tryp_SPc 37..219 CDD:238113 65/194 (34%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 3/21 (14%)
Tryp_SPc 265..498 CDD:238113 79/238 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.