DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC101732176

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:244 Identity:88/244 - (36%)
Similarity:121/244 - (49%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEPRIVGGIKAKQGQFPHQISL-RLRGE--HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQ 94
            ::.|||||..|..|.:|.|||| :|.|.  :.|||.||:...::||.||| :|....|: ::.:.
 Frog   273 VDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCV-YGYTSSPS-IFKVF 335

  Fly    95 AGSLLLS---SDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLAT-----ED 150
            ||||.||   |.|..  |..|::||:|:....| |:|:|:|::.|.|..|:..:.|..     .|
 Frog   336 AGSLTLSNYYSAGYL--VDRVLIHPSYSPNTQNYDIALLKLKTALVFSTNLRPVCLPNVGMPWAD 398

  Fly   151 PPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRW--MFYSRLPETMICLLH-SKNSGAC 212
            ...|.   |||||..:|.|.:|.||....|..||...|..  ::...:..||||..: ...:..|
 Frog   399 GQPCW---ISGWGTTSEAGSISTSLKAASVPIISSATCNLAPVYGGVISPTMICAGYLGGGTDTC 460

  Fly   213 YGDSGGPATYGGK----VVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            .||||||......    :||..|  .|.||.|| .|..|..|:....||
 Frog   461 QGDSGGPLVTKTNSLWWLVGDTS--WGYGCARAYKPGVYGNITVFLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 86/239 (36%)
Tryp_SPc 37..219 CDD:238113 72/196 (37%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055
Tryp_SPc 277..510 CDD:238113 87/240 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.