DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC101730792

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:137 Identity:39/137 - (28%)
Similarity:59/137 - (43%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AVLRLQSPLTFDANIAAIQLATE--DPPNCVAVDISGWGNIAE-KGPLSDSLLFVQVTSISRGAC 188
            |:|.|..|..::|.::.:.|..:  .|.......:||||..:. .|..||:|..|::..:....|
 Frog     7 ALLPLNRPAFYNAFVSVVPLPIQGVSPIEGRLCQVSGWGFTSTIGGKPSDTLRSVKLPIVPMRKC 71

  Fly   189 R--WMFYSRLPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA-PDGYLRI 249
            .  ..:...:...|||. ..:....||.||||||....|||.|:.|  .|..|.... |..|..:
 Frog    72 NSSASYAGHITSNMICAGFITGGKDACQGDSGGPLVCDGKVYGVVS--WGHSCANPKYPGVYTAV 134

  Fly   250 SKVRAWI 256
            :..:.||
 Frog   135 ANFQRWI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 37/135 (27%)
Tryp_SPc 37..219 CDD:238113 26/97 (27%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 37/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.