DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tpsab1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:251 Identity:77/251 - (30%)
Similarity:114/251 - (45%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLRLRGE---HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSL 98
            ||||.:|...::|.|:|||....   |:|||.:|....|:||.|||  |.||...:...:|....
Mouse    29 IVGGQEAHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCV--GPDVADPNKVRVQLRKQ 91

  Fly    99 LLSSDGVRIPVAEVIMHPN-YATGGHNDLAVLRLQSPLTFDANIAAIQL--ATEDPPNCVAVDIS 160
            .|......:.|:::|.||: |......|:|:|:|.:|:.....:..:.|  |:|..|:.....::
Mouse    92 YLYYHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPASETFPSGTLCWVT 156

  Fly   161 GWGNIAEKG-------PLSDSLLFVQVTSISRGACRWMFYSRL---------PETMICLLHSKNS 209
            ||||| :.|       ||.:    |||..|....|...::..|         .:.|:|   :.|.
Mouse   157 GWGNI-DNGVNLPPPFPLKE----VQVPIIENHLCDLKYHKGLITGDNVHIVRDDMLC---AGNE 213

  Fly   210 G--ACYGDSGGPATYGGKV------VGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            |  :|.||||||...  ||      .|:.|  .|.||.:. .|..|.|::....||
Mouse   214 GHDSCQGDSGGPLVC--KVEDTWLQAGVVS--WGEGCAQPNRPGIYTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/249 (30%)
Tryp_SPc 37..219 CDD:238113 63/205 (31%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 77/251 (31%)
Tryp_SPc 29..265 CDD:214473 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.