DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC100498083

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_012810073.2 Gene:LOC100498083 / 100498083 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:265 Identity:76/265 - (28%)
Similarity:120/265 - (45%) Gaps:49/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74
            |||:|   |:||...|.:      :.:|:||....:...|:.:||. .|.|:|||.:|:...|::
 Frog     3 LLLIC---VLLGAAAAFD------DDKIIGGATCAKNSVPYIVSLN-AGYHFCGGSLINNQWVVS 57

  Fly    75 AGHC------VKHGNDVVPADLWSIQAGSLLLSSDGVR--IPVAEVIMHPNYATGG-HNDLAVLR 130
            |.||      |:.|...:..             |:|..  |..|:||.|..|.:.. .||:.:::
 Frog    58 AAHCYQASVQVRLGEHNIAV-------------SEGTEQFINSAKVIRHSGYNSRTLDNDIMLIK 109

  Fly   131 LQSPLTFDANIAAIQLATEDPPNCVAVD----ISGWGNIAEKGPLSDSLL-FVQVTSISRGACRW 190
            |.|..:.::.:.|:.|    |.:|.|..    ||||||.:..|....:|| .:....::...|..
 Frog   110 LSSAASLNSAVNAVAL----PSSCAAAGTSCLISGWGNTSASGSNYPNLLQCLNAPILTTAQCSG 170

  Fly   191 MFYSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISK 251
            .:..::...|.|   |...|:|  |.||||||....|::.|:.|  .|.||. |..|..|.::..
 Frog   171 AYPGQITNNMFCAGFLEGGKDS--CQGDSGGPVVCNGQLQGIVS--WGIGCAQRNYPGVYTKVCN 231

  Fly   252 VRAWI 256
            ..:||
 Frog   232 YNSWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/237 (28%)
Tryp_SPc 37..219 CDD:238113 55/198 (28%)
LOC100498083XP_012810073.2 Tryp_SPc 21..239 CDD:238113 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.