DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:239 Identity:75/239 - (31%)
Similarity:114/239 - (47%) Gaps:23/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSL 98
            |.|||||..|..|.:|.|::|:....:.|||.:|:|..::||.|||:  .|.....||....|.:
 Frog   258 ESRIVGGSSASIGDWPWQVNLQYDDTNLCGGSVIAANWIVTAAHCVQ--GDTSSPSLWKAFIGKI 320

  Fly    99 LLSS--DGVRIPVAEVIMHPNYAT-GGHNDLAVLRLQSPLTFDANIAAIQLAT-----EDPPNCV 155
            .:.|  |.....|..:|:||:|:: ...||:|:::|::.:.|.:....:.|..     |:...|.
 Frog   321 KMPSYYDSSAYSVDRIIVHPDYSSQTNSNDIALMKLKTSIAFSSISRPVCLPNYGMQWEEGQPCY 385

  Fly   156 AVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRW--MFYSRLPETMICLLHSKNS-GACYGDSG 217
               |||||..::||.:|..|.:..|..||...|..  |:...:..:|||..:.|.. .:|.||||
 Frog   386 ---ISGWGTTSQKGSISSVLKYAMVPLISPTTCNQTIMYNGAITSSMICAGYPKGGVDSCQGDSG 447

  Fly   218 GPATYGGK----VVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            ||......    :||..|  .|.||... .|..|..::....||
 Frog   448 GPLVTKTNSLWWLVGDTS--WGDGCANVYRPGVYGNMTVFLQWI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/235 (31%)
Tryp_SPc 37..219 CDD:238113 61/192 (32%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055
Tryp_SPc 261..489 CDD:238113 71/234 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.