DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and XB5892359

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752073.1 Gene:XB5892359 / 100497443 XenbaseID:XB-GENE-5892360 Length:426 Species:Xenopus tropicalis


Alignment Length:250 Identity:68/250 - (27%)
Similarity:113/250 - (45%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGE----HYCGGVIISATHVITAGHC-VKHGNDVVPADLWSIQA 95
            |::.|..|:.|.:|..:|:::..:    |.|||.:::...|:||.|| :|:.::   ..|..|..
 Frog    22 RVIDGANAQPGSWPWIVSIQMPIDSVYRHVCGGTVLNHHWVMTAAHCLLKYQSE---QSLARIVF 83

  Fly    96 GSLLLSSDG----VRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANI--AAIQLATEDPPN 153
            |...:|..|    :| .:.|:|.|.:: .....||:|::.|..|:.|...|  |.:...:.|...
 Frog    84 GLFNVSDLGPETQIR-KIKEMIRHEHFNKKENKNDIALIYLDRPVAFSDYIQPACLPQQSSDITR 147

  Fly   154 CVAVDISGWGNIAEKGPL-SDSLLFVQVTSISRGACR---WMFYSRLPETMICL-LHSKNSGACY 213
            .....|:|||.:.:...: :|.|...:...|:...|.   | :..|:.|..:|. ........|.
 Frog   148 MNDCYIAGWGLVDDYFRIRTDVLQEAKTELIANSRCNQSDW-YNGRIKEYNLCAGFEHGGPDTCD 211

  Fly   214 GDSGGP--------ATYGGKVVGLASLLLGGGCGRAAPDG-YLRISKVRAWIAEK 259
            ||||||        .||  .:||:||  .||.||.:..:| |......:.||.:|
 Frog   212 GDSGGPLMCKRMKAKTY--YIVGIAS--WGGLCGHSYRNGVYTATQYFKEWILDK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 65/245 (27%)
Tryp_SPc 37..219 CDD:238113 50/198 (25%)
XB5892359XP_031752073.1 Tryp_SPc 22..259 CDD:214473 65/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.