DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC100495541

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:282 Identity:81/282 - (28%)
Similarity:131/282 - (46%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLCGVQVILGQDVAQNQSES-----------AIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGV 65
            |||...:.:.:|.:.:.|.|           .:..|||||..|..|.:|.|:||...|.|.|||.
 Frog   326 LLCIWLIAMAKDSSVSPSVSDTTSTLSCGSPLVSNRIVGGTDATDGAWPWQVSLDYHGSHICGGS 390

  Fly    66 IISATHVITAGHCVKHGNDVVPADLWSIQAGSL---LLSSDGVRIPVAEVIMHPNYATGGHNDLA 127
            :|:...::||.||.::...  |:| :.|:.|:.   |:|...:...|..:|::...::..:.|:|
 Frog   391 LIATQWIMTAAHCFEYSKS--PSD-YKIRLGAYQLSLISPHEITSTVDSIIVNSPNSSSTNTDIA 452

  Fly   128 VLRLQSPLTFDANIAAIQLATEDPPNCVAVD--ISGWGNIAEKGPLSDSLLFVQVTS--ISRGAC 188
            ::||.||:|:...|..|.|.:........::  ::|||.||.:..|...:...||.:  |||..|
 Frog   453 LIRLTSPITYTKYILPICLPSTSDGFTEGMECWVTGWGTIASQVNLPYPMTLQQVMTPLISRATC 517

  Fly   189 RWMFYSR------LPETMICLLHSK-NSGACYGDSGGPAT-------YGGKVVGLASLLLGGGCG 239
            ..|:.:.      :|...||..::. ...:|.||||||..       |   .:|:.|  .|.||.
 Frog   518 NQMYNTDSLLSVVVPLDQICAGYAAGQKDSCQGDSGGPLVCQLQGIWY---QIGIVS--WGEGCA 577

  Fly   240 -RAAPDGYLRISKVRAW-IAEK 259
             |..|..|..:....:| |||:
 Frog   578 VRNRPGVYTLVPAYYSWVIAEE 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/242 (30%)
Tryp_SPc 37..219 CDD:238113 59/195 (30%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113
Tryp_SPc 362..595 CDD:238113 70/240 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.