DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and prss12

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002934300.3 Gene:prss12 / 100495119 XenbaseID:XB-GENE-984837 Length:851 Species:Xenopus tropicalis


Alignment Length:282 Identity:78/282 - (27%)
Similarity:130/282 - (46%) Gaps:54/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEH-----YCGGVIISATH 71
            |:||.::       |::...    ||:||..:.:|.:|.|::|||:..|     .||..:||:..
 Frog   593 LVCGSRL-------QHRRPK----RIIGGKNSVRGGWPWQVALRLKSSHGDGRLLCGATLISSCW 646

  Fly    72 VITAGHCVK-HGNDVVPADLWSIQAG---SLLLSSDGVRIPVAEVIMHPNYATGGHN-DLAVLRL 131
            |:||.||.| :||:   ...:.|:.|   :|:.......:.:.::|:|.:|...|:: |:|::||
 Frog   647 VLTAAHCFKRYGNN---TRSYVIRVGDYHTLVPEEYEEDMTIQQIIIHNDYRPDGNDYDIALIRL 708

  Fly   132 QSPLTFDANIAAIQLATEDPPNCVAVD------------ISGWGNIAEKGPLSDSLLFVQVTSIS 184
            .....     ..:||:|...|.|:.:.            |:|||:...  ..|.:|....||.:.
 Frog   709 HGTAE-----QCVQLSTHVLPACLPLRRERPQKTASNCYITGWGDTGR--AYSRTLQQATVTLLP 766

  Fly   185 RGACRWMFYSRLPETMIC---LLHSKNSGACYGDSGGPAT---YGGK--VVGLASLLLGGGCG-R 240
            :..|...:.|:....|:|   :...|:..:|.||||||..   .||.  |.|:.|  .|.||| :
 Frog   767 KRVCEERYRSQFTGRMLCAGSVKTQKHVDSCQGDSGGPLVCERSGGSWIVYGVTS--WGYGCGVK 829

  Fly   241 AAPDGYLRISKVRAWIAEKAGL 262
            .:|..|.::|....||.....|
 Frog   830 DSPGVYTKVSAFIPWIKSVTNL 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/250 (28%)
Tryp_SPc 37..219 CDD:238113 56/206 (27%)
prss12XP_002934300.3 KR 78..140 CDD:412161
SRCR 148..244 CDD:395421
SR 257..356 CDD:214555
SR 363..461 CDD:214555
SR 476..575 CDD:214555
Tryp_SPc 607..848 CDD:238113 72/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.