DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC100490788

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001333500.1 Gene:LOC100490788 / 100490788 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:260 Identity:67/260 - (25%)
Similarity:111/260 - (42%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            ||.::.|.:.....:...|            :||||.:......|.|:.....|.::|||.:||.
 Frog     4 LWVLMFLAVAAAAPLDDDD------------KIVGGYECTPHSQPWQVFFTFNGRNWCGGSLISP 56

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGV--RIPVAEVIMHPNYATGGH-NDLAVLRL 131
            ..:|:|.||.:     .|..|.::.....|...:|.  .|.|.....|..|....: :|:.:::|
 Frog    57 RWIISAAHCYQ-----PPKTLVALLGEHDLKKKEGTEQHIQVEAAYKHFGYKDEAYDHDIMLVKL 116

  Fly   132 QSPLTFDANIAAIQLATEDPPNCVAVDISGWGN-IAEKGPLSDSLLFVQVTSISRGACRWMFYSR 195
            ..|..::..:..|.:|...|.:.....:||:|| :|......|.|..:.:..:|..:|:..:..:
 Frog   117 AKPAQYNQYVQPIPVARSCPTDGAKCLVSGYGNLLAYNIRYPDQLQCLDLPILSDSSCKASYPRQ 181

  Fly   196 LPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            :.|.|.|   |...|:|  |.||||||....|::.|:.|  .|..|.|. ||..|.::.....||
 Frog   182 ISENMFCAGFLEGEKDS--CQGDSGGPLICSGELYGVVS--WGRYCARKNAPGVYAKVCNYLDWI 242

  Fly   257  256
             Frog   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/227 (27%)
Tryp_SPc 37..219 CDD:238113 50/188 (27%)
LOC100490788NP_001333500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.