DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and tmprss15

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752048.1 Gene:tmprss15 / 100490249 XenbaseID:XB-GENE-999987 Length:994 Species:Xenopus tropicalis


Alignment Length:266 Identity:67/266 - (25%)
Similarity:123/266 - (46%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEP-----RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVI 73
            |..|.::.....|.:....:.|     :||||..|..|.:|..:||.......||..:::...::
 Frog   732 CANQSVIHIQCQQRECGKRLVPIKSGSKIVGGSDAALGAWPWIVSLYYNDRQTCGASLVNQEWLV 796

  Fly    74 TAGHCVKHGNDVVPADLWSIQAG---SLLLSSDGVRIP-VAEVIMHPNY-ATGGHNDLAVLRLQS 133
            :|.||| :|.:::|:: |..:.|   :|.|:...:... :.:::::|.| .....:|:.::.||.
 Frog   797 SAAHCV-YGRNLIPSN-WKARLGLHTNLNLTQPQIATQMIDQIVINPQYNRRTKDSDIVMMHLQF 859

  Fly   134 PLTFDANIAAIQLATEDPPNCVAVD--ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRL 196
            .:.:...|..|.|...|....|.::  |:|||.....||:.:.|...::..||...|:    .::
 Frog   860 KVNYSDYIQPICLPETDQEFSVGINCSIAGWGRTQSGGPVPNILQEAEIPLISNHKCQ----QQM 920

  Fly   197 PE-----TMICLLHSKNS-GACYGDSGGPATYGGK----VVGLASLLLGGGCGR-AAPDGYLRIS 250
            ||     .|:|..:.:.. ..|.||||||......    :||:.|  .|.||.: :.|..|:|::
 Frog   921 PEYNITDNMVCGGYEEGGIDTCQGDSGGPMMCQQNNEWFLVGVTS--FGYGCAQPSRPGVYVRVT 983

  Fly   251 KVRAWI 256
            :...||
 Frog   984 EFTNWI 989

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/237 (26%)
Tryp_SPc 37..219 CDD:238113 50/194 (26%)
tmprss15XP_031752048.1 SEA 36..>103 CDD:396113
LDLa 157..190 CDD:197566
CUB 199..305 CDD:238001
MAM 321..478 CDD:395504
CUB 501..608 CDD:395345
LDLa 620..654 CDD:238060
SR 655..746 CDD:214555 3/13 (23%)
Tryp_SPc 760..991 CDD:238113 63/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.