powered by:
Protein Alignment CG32523 and akt1
DIOPT Version :9
Sequence 1: | NP_728401.1 |
Gene: | CG32523 / 318071 |
FlyBaseID: | FBgn0052523 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004917247.1 |
Gene: | akt1 / 100490038 |
XenbaseID: | XB-GENE-484953 |
Length: | 493 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 21/72 - (29%) |
Similarity: | 31/72 - (43%) |
Gaps: | 15/72 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 LLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQL-ATEDP-PNCVAVDISG 161
||.:||..|...| .|. .|.:|::||. :.::|..|| .||.| ||...:....
Frog 28 LLKTDGTFIGYKE---RPQ---------DVDQLETPLN-NFSVAKCQLMKTERPKPNTFIIRCLQ 79
Fly 162 WGNIAEK 168
|..:.|:
Frog 80 WTTVIER 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E33208_3BBP0 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.