DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and akt1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_004917247.1 Gene:akt1 / 100490038 XenbaseID:XB-GENE-484953 Length:493 Species:Xenopus tropicalis


Alignment Length:72 Identity:21/72 - (29%)
Similarity:31/72 - (43%) Gaps:15/72 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQL-ATEDP-PNCVAVDISG 161
            ||.:||..|...|   .|.         .|.:|::||. :.::|..|| .||.| ||...:....
 Frog    28 LLKTDGTFIGYKE---RPQ---------DVDQLETPLN-NFSVAKCQLMKTERPKPNTFIIRCLQ 79

  Fly   162 WGNIAEK 168
            |..:.|:
 Frog    80 WTTVIER 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 21/72 (29%)
Tryp_SPc 37..219 CDD:238113 21/72 (29%)
akt1XP_004917247.1 PH_PKB 4..111 CDD:269947 21/72 (29%)
PKc_like 125..491 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.