DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and zgc:171509

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:266 Identity:70/266 - (26%)
Similarity:110/266 - (41%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATH 71
            :::.:||.||.|....|            :|:||.:.:....|.|..|. .|...|||.:|..:.
Zfish     3 SIVFILLIGVVVHSKGD------------KIIGGHECQPHSQPWQARLD-DGYGLCGGSLIHESW 54

  Fly    72 VITAGHCV---------KHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH-NDL 126
            |::|.||.         ||...||......|||              .:||.||.|....| ||:
Zfish    55 VVSAAHCKSSSIIVHLGKHDLFVVEDTAQEIQA--------------EKVISHPKYNNREHNNDI 105

  Fly   127 AVLRLQSPLTFDANIAAIQLATEDPPNCVAVD----ISGWGNIAEKGPLSDSLLFVQVTSISRGA 187
            .:::|:.|...:.|:..:.|    |.||....    :||||...:.  :|.:|..:::..:|:..
Zfish   106 MLIKLREPAVINNNVKPVPL----PTNCSHAGEQCLVSGWGVTGDS--ISSTLQCLELPILSKAD 164

  Fly   188 CRWMFYSRLPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAA-PDGYLRIS 250
            |:..:...:.:.|.|. .......:|.||||||....|.:.|:.|  .|.||.... |..|:.:.
Zfish   165 CKSAYGRVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGTLKGIVS--FGIGCAEPGFPGVYVEVC 227

  Fly   251 KVRAWI 256
            :...||
Zfish   228 RYINWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/235 (26%)
Tryp_SPc 37..219 CDD:238113 52/196 (27%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 62/235 (26%)
Tryp_SPc 21..234 CDD:238113 64/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.