DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and ctsg

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001107513.1 Gene:ctsg / 100135369 XenbaseID:XB-GENE-5953471 Length:235 Species:Xenopus tropicalis


Alignment Length:208 Identity:48/208 - (23%)
Similarity:86/208 - (41%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGV--------RIPVAEVIMHPNY 118
            |||::||...|:||.||.:.....:.....:.....::|.:..:        :|.|.|.|..|.|
 Frog    19 CGGILISEEFVLTAAHCAESQASWISTKRKAYSKIVVILGAHNIDEQEQSQQKIGVCEQIKPPEY 83

  Fly   119 AT-GGHNDLAVLRLQSPLTFDANIAAIQLATEDP---PNCVAVDISGWGNI-AEKGPLSDSLLFV 178
            :| ...:|:.:|:|......:..:..|:.....|   |:.:. :::|||.| .....::..|..:
 Frog    84 STQRDEHDIMLLKLMKKAVPNQYVLPIRPRQSGPKLEPHNLC-NVAGWGRINTFNDKMASKLQEL 147

  Fly   179 QVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAP 243
            .:|.::...|...|.....:..||..::....:|.||||||......:.||.:   ||......|
 Frog   148 NMTIVAPDECAKAFPRVNTKKCICAKNTDKKSSCRGDSGGPLFCNQYLHGLVN---GGNEKCTGP 209

  Fly   244 DGYLRISKVRAWI 256
            ..:..:.....||
 Frog   210 RLFTNVFSHIEWI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 46/206 (22%)
Tryp_SPc 37..219 CDD:238113 39/169 (23%)
ctsgNP_001107513.1 Tryp_SPc 1..225 CDD:238113 48/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.