DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and zgc:165423

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:280 Identity:91/280 - (32%)
Similarity:130/280 - (46%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVI-LGQDVAQNQSESA-----IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIIS 68
            |.|||.|.:: .|.|....||..|     :..:||||..|..|.:|.|.||...|.|:|||.:||
Zfish     5 LSLLCVVTLLSTGCDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLIS 69

  Fly    69 ATHVITAGHCVKHGNDVVPADLWSIQAGSL---LLSSDGVRIPVAEVIMHPNYATGGH-NDLAVL 129
            ...:::|.||.....:  |:| :::..|..   |.:.:.|...|::||:||.|....| ||:|:|
Zfish    70 DQWILSAAHCFPSNPN--PSD-YTVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALL 131

  Fly   130 RLQSPLTFDANIAAIQLATEDPPNCVAVD----------ISGWGNIAEKG---PLSDSLLFVQVT 181
            .|.||:||...|         .|.|:|.|          |:|||.| |.|   |....|..|.|.
Zfish   132 HLSSPVTFSNYI---------QPVCLAADGSTFYNDTMWITGWGTI-ESGVSLPSPQILQEVNVP 186

  Fly   182 SISRGACRWMF--YSRLPETMICL-LHSKNSGACYGDSGGP---ATYGGKV-VGLASLLLGGGCG 239
            .:....|..::  .|.:...|:|. |......:|.||||||   .::...| .|:.|  .|.||.
Zfish   187 IVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVS--FGKGCA 249

  Fly   240 RA-APDGYLRISKVRAWIAE 258
            .. .|..|.|:|:.:.||::
Zfish   250 DPNYPGVYARVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/244 (32%)
Tryp_SPc 37..219 CDD:238113 67/201 (33%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 79/244 (32%)
Tryp_SPc 38..269 CDD:238113 81/245 (33%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.