DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:258 Identity:70/258 - (27%)
Similarity:118/258 - (45%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISAT 70
            ::||||:.....:.|         :::::..||.|.:|:....|:.:|::...:|.|||.::|..
Zfish     3 FSVLLLVYLLPNLTL---------QASVKSGIVNGNEARPHSRPYMVSVQCNRKHICGGFLVSEQ 58

  Fly    71 HVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSP 134
            .|:||.||..:|.::      ::..|:...:....|:.|....:||.:.:.. .||:.:|:|...
Zfish    59 FVMTAAHCFVNGKEL------TVVVGAHEYTDGASRMDVKFYHIHPGFESKTLLNDIMLLQLHKK 117

  Fly   135 L--TFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACR--W-MFYS 194
            :  :...|...|..|.:|........::|||.....|.:|..|:.|.||...:.||:  | ..||
Zfish   118 VKKSNKVNWIPIPNADKDIKAKTKCSVAGWGKNTTHGEVSAKLMEVNVTLFDKKACQKYWGPTYS 182

  Fly   195 RLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGC-GRAAPDGYLRISKVRAWI 256
              ...|:|.  ..:.|.|.||||||.......||:.|......| ....|:.|.:|||..:||
Zfish   183 --TSKMMCT--GGHGGFCQGDSGGPLVCDKVAVGIVSFNEKNNCDSPTKPNVYTQISKFLSWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/226 (28%)
Tryp_SPc 37..219 CDD:238113 52/187 (28%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.