DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and zgc:163079

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:275 Identity:78/275 - (28%)
Similarity:128/275 - (46%) Gaps:29/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WTTLWTVLLLLLCGVQVILGQ-DVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRG--EHYCG 63
            :.:::.|...:|..:...||| ||.   ..:.:..:|:||:.|.||.:|.|.|:.|:.  |.|||
Zfish     3 FNSVFCVAGAILLNIAGCLGQSDVC---GRAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCG 64

  Fly    64 GVIISATHVITAG--HCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDL 126
            |.:|:...|:|..  ..:...:|:|.......|.||   :...:...|.::|.||||.:...| |
Zfish    65 GSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNGS---NPYEISRTVTKIIKHPNYNSLDSN-L 125

  Fly   127 AVLRLQSPLTFDANIAAIQLATEDPPNCVAVD-----ISGWGNI-----AEKGPLSDSLLFVQVT 181
            |:|:|.||:||...|..:.||.   ...|.||     ::|||.:     .|:..|.|.|..|:..
Zfish   126 ALLKLSSPVTFSDYIKPVCLAA---AGSVFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAP 187

  Fly   182 SISRGACRWMFYSRLPETMIC--LLHSKNSGACYGDSGGPATYGGKVVGLAS-LLLGGGCGRAA- 242
            .::...|...:...:...::|  .|:......|.||.|||.......:.:.| :::.|.||... 
Zfish   188 IVNNFECNAAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGY 252

  Fly   243 PDGYLRISKVRAWIA 257
            |..|:|:|:...||:
Zfish   253 PTIYVRVSEYEDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/237 (29%)
Tryp_SPc 37..219 CDD:238113 59/197 (30%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 69/237 (29%)
Tryp_SPc 36..267 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.