DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC100004427

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:279 Identity:73/279 - (26%)
Similarity:121/279 - (43%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLCGVQVILGQ-DVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLR--GEHYC 62
            |:.|::.|...:|..:...||| ||.   ..:.:..:||||:.|.:|.:|.|.|:..:  |:.:|
Zfish     2 MFNTVFCVAGAVLLNIAGCLGQSDVC---GRAPLNTKIVGGLNATEGSWPWQASINFKSTGQFFC 63

  Fly    63 GGVIISATHVITAGHCVKHGN--DVVPADLWSIQAGSLLLSSDG--------VRIPVAEVIMHPN 117
            .|.:||...|:||..|.:..|  |||      |..|.|..:...        :::.|.|      
Zfish    64 SGSLISERWVLTAASCFQRINVSDVV------IYLGRLTTNGSNPYEIPRTVIQVSVTE------ 116

  Fly   118 YATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD-----ISGWGNIAEKGP-LSDSLL 176
                   |:|:::|.|.:||...|..:.||.   ...|.||     ::|||:.:.... |||.|.
Zfish   117 -------DIALVQLSSSVTFTDYIRPVCLAA---AGSVFVDGTESWVTGWGSTSSTNVILSDMLK 171

  Fly   177 FVQVTSISRGACRWMFYSRLPETMIC--LLHSKNSGACYGDSGGP-ATYGGKVVGLASLLLGGGC 238
            .|:...::...|..:......:.:||  .::......|:.|.|.| .|..|.....:.:::...|
Zfish   172 EVEAPIVNNIECSNINGITNLDNVICAGFVNETGKAPCWEDFGSPLVTRQGSQWIQSGVVVFTFC 236

  Fly   239 GR-AAPDGYLRISKVRAWI 256
            |: ..|..|.|:|:...||
Zfish   237 GQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/241 (26%)
Tryp_SPc 37..219 CDD:238113 53/201 (26%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 62/241 (26%)
Tryp_SPc 36..257 CDD:238113 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.