DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and gzm3.4

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:238 Identity:61/238 - (25%)
Similarity:105/238 - (44%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            :|..||||.:.|....|:..||:::.:|.|||::|...:|:|:.||.|...::           .
Zfish    21 MESGIVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTSAHCWKDTTNL-----------E 74

  Fly    98 LLLSSDGVR--------IPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLATEDPPN 153
            ::|.:..:.        |.|.:.|.||||....|: |:.:|:|::....:..:....|...:|..
Zfish    75 VVLGAHNISQRENSQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHFVNITNLPKHEPSI 139

  Fly   154 CVAVD--ISGWGNIAEKGPLSDSLLFVQVTSISRGAC--RWMFYSRLPETMICLLHSKNSGACYG 214
            ...|:  |:|||........|:.|..|.:...|...|  :|..|.. .:.|:|.........|.|
Zfish   140 LAPVECSIAGWGMQRPGEGASNVLREVNLQLESNSYCKSKWQVYFN-SKNMVCTASDGKKAFCQG 203

  Fly   215 DSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWI 256
            |||.|.....::.|:|:......|. :..|:.|:::|....||
Zfish   204 DSGSPLFCNSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 58/233 (25%)
Tryp_SPc 37..219 CDD:238113 51/194 (26%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 60/234 (26%)
Tryp_SPc 25..246 CDD:214473 58/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.