DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and gzm3.3

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:268 Identity:70/268 - (26%)
Similarity:112/268 - (41%) Gaps:38/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITA 75
            :.||...::|...:|     ..::..|:||..||....|:..|:::...|.|||::|...:|:||
Zfish     1 MALCTFLLLLAISLA-----GGMDSGIIGGKVAKAHSRPYMASIQINKHHTCGGMLIRDDYVLTA 60

  Fly    76 GHCVKHGNDVVPADLWSIQAG----SLLLSSDGV--------RIPVAEVIMHPNYATGGHN---- 124
            .||:..|          :.:|    .::|.:..:        ||.|.:.|.||.:......    
Zfish    61 AHCLNRG----------VYSGRGHLEVVLGAHNISKHEQNQQRIQVKKYIRHPMFQRNKEKDYSY 115

  Fly   125 DLAVLRLQSPLTFDANIAAIQLATED---PPNCVAVDISGWGNIAEKGPL-SDSLLFVQVTSISR 185
            |:.:|:|::.......:..|.|..::   |.| |...::|||....|..| ||.|..|.:.....
Zfish   116 DIMLLKLKNKAKISKFVKVISLPKKNGKIPAN-VKCSVAGWGLTKPKAELASDVLEEVTLKLQFD 179

  Fly   186 GACRWMFYSRL-PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGC-GRAAPDGYLR 248
            ..|:.|:.... .|.|||.:.......|.||||||.....|...:.|....|.| .:..|..:|:
Zfish   180 FECKTMWQQHFNTERMICSVSDGKHAFCQGDSGGPLICNTKPQAIVSYTFEGNCINKQYPQVFLK 244

  Fly   249 ISKVRAWI 256
            ||....||
Zfish   245 ISYFLPWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 64/241 (27%)
Tryp_SPc 37..219 CDD:238113 54/202 (27%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 66/242 (27%)
Tryp_SPc 22..252 CDD:214473 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.