DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and gzm3.2

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001341145.4 Gene:gzm3.2 / 100001065 ZFINID:ZDB-GENE-070912-133 Length:247 Species:Danio rerio


Alignment Length:264 Identity:65/264 - (24%)
Similarity:118/264 - (44%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74
            ::||| |.::|    :.......:|..||||.:||....|:..||:.:..|.|||::|...:|:|
Zfish     4 IMLLC-VFLLL----SLFSLSGGLESGIVGGREAKHHSRPYMASLQKKRNHVCGGMLIKEDYVLT 63

  Fly    75 AGHCVKHGNDVVPADLWSIQAGSLLLSSDGVR--------IPVAEVIMHPNYATGGHNDLAVLRL 131
            :.||...      .|.:|:|   ::|.:..:.        |.|.:.|.|..:      |:.:|:|
Zfish    64 SAHCWNE------TDKYSLQ---IVLGAHNISQKENSQQIIQVEKYIKHRKF------DIMLLKL 113

  Fly   132 QSPLTFDANIAAIQLATED-----PPNCVAVDISGWGNIAEKGPLSDSLLFV---QVTSISRGAC 188
            ::....:..:..|.|...:     |..|   .|:||| :...|..:.::|.|   |:.|.::...
Zfish   114 RTKAVLNHFVDIINLPKHEISILAPLEC---SIAGWG-MKRPGEGASNVLRVVNLQLESNAKCKS 174

  Fly   189 RWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKV 252
            :|..:... :.|:|.:.......|.||||.|.....::.|:|:......|. :..|:.|:::|..
Zfish   175 KWQTHFNF-KNMVCTVSDGKKAFCQGDSGSPLLCNSELYGMAAYTYPKNCTFKEYPEVYMKVSAF 238

  Fly   253 RAWI 256
            ..||
Zfish   239 LPWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 57/236 (24%)
Tryp_SPc 37..219 CDD:238113 50/197 (25%)
gzm3.2XP_001341145.4 Tryp_SPc 26..245 CDD:238113 59/237 (25%)
Tryp_SPc 26..242 CDD:214473 57/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.