DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34120 and si:cabz01083442.1

DIOPT Version :9

Sequence 1:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster
Sequence 2:XP_005172448.2 Gene:si:cabz01083442.1 / 101883419 ZFINID:ZDB-GENE-161017-133 Length:144 Species:Danio rerio


Alignment Length:121 Identity:31/121 - (25%)
Similarity:55/121 - (45%) Gaps:11/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1829 VSEIEHLCQRVAVLRAGQVIASDSPQRLKSEHG-GYYAVTCFCGPAQQA-ILSRSLNQRLPGARD 1891
            :.|.|.||.|:|::..||.....|.|.|||..| ||..:...|...... .|...:.:..||:..
Zfish     1 MEECEALCTRMAIMVNGQFQCLGSIQHLKSRFGDGYTLIVRVCADVSDLDALETFVKETFPGSVL 65

  Fly  1892 LQHYAHSLRFLVRVRSPGSLGDAPLLSELFAILC--DVCVNVARFSLSRCRFETVF 1945
            .:.:.::|::.:    |.:.|   .|:.:|:.|.  ...:.|..:|:|:...:.||
Zfish    66 KEKHHNTLQYQI----PPADG---ALTHIFSQLSTHQHTLRVEDYSVSQTTLDQVF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468
ABC_subfamily_A 859..1073 CDD:213230
drrA 865..1162 CDD:130256
ABC2_membrane_3 1230..1601 CDD:289468
Mem_trans 1436..>1552 CDD:304621
ABC_subfamily_A 1651..1857 CDD:213230 10/27 (37%)
drrA 1666..1945 CDD:130256 29/119 (24%)
si:cabz01083442.1XP_005172448.2 P-loop_NTPase <1..29 CDD:304359 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000051
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.