DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng5a

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001313491.1 Gene:cacng5a / 797409 ZFINID:ZDB-GENE-120104-4 Length:289 Species:Danio rerio


Alignment Length:224 Identity:64/224 - (28%)
Similarity:101/224 - (45%) Gaps:30/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEEK--LPNANYNGTANFKALDDGAYITKYTKSSLWIL 287
            |.|::.|.|..|:.::..|::...||:.||.  ||            |:....|.....|.||.:
Zfish     9 LTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGVILP------------LNQSTEIRMSLHSGLWRV 61

  Fly   288 C---------TTLP-GLDADSY-NCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFL 341
            |         |.|| |...|.. .|..|:|......|. ..:|||::...:..:.|..|.:..|:
Zfish    62 CFLSESPASGTVLPTGKSGDEKGRCFTIEYVMPMNVQM-TSESTASVLKMIRSATPFPLVSLFFM 125

  Fly   342 VISFIVFLIPTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIK 406
            .|.|::..|.....|..:..|.:||.||:|||.:::||:.|||    .|..::..|:....|...
Zfish   126 FIGFVLSNIGHIRPQRTILAFISGIFFILSGLSLVVGLVLYIS----SINDEMLNRTKTNEAYFS 186

  Fly   407 VSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
            ..||.||......|::||..||::::||:
Zfish   187 YKYGWSFAFAAVSFLLTEAAGVMSVYLFM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 57/206 (28%)
cacng5aNP_001313491.1 PMP22_Claudin 8..209 CDD:304458 61/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577603
Domainoid 1 1.000 66 1.000 Domainoid score I9896
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm24542
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.