DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng3a

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_021331621.1 Gene:cacng3a / 567438 ZFINID:ZDB-GENE-090312-124 Length:407 Species:Danio rerio


Alignment Length:238 Identity:63/238 - (26%)
Similarity:98/238 - (41%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 SNMTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK- 278
            :.|...|.|...|:|...|..:.:::..|:....||::         .|....|:::|.....| 
Zfish     6 ARMRVCNRGVQMLLTTAGAFAAFSLMTIAVGTDYWLYS---------RGVCRTKSVNDNDTNRKN 61

  Fly   279 ---YTKSSLWILCTTLPGLDADSYNCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFLAAGV 339
               .|.|.||..| .:.|:....  |..||:|..:. |:.|      |..|.:.    ...|:.:
Zfish    62 EEVLTHSGLWRQC-CMEGIFKGV--CKNIDHFPEDADYEQD------AAEYLLR----AVRASSL 113

  Fly   340 FLVISF-IVFLIPTCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPR 397
            |.::|. ::|:...|...:..|      ..||||.|:.:||..:||:|.|||....:.......|
Zfish   114 FPIMSVGLLFIGGVCVAASEFYKSRHNVILSAGIFFVSAGLSNIIGIIVYISSSAGDPNQSESKR 178

  Fly   398 STLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFINLQEV 440
            |..        ||.||:.....||:.|.||||.:.|||:...|
Zfish   179 SHW--------YGWSFYCGALSFIIAETVGVLTVHLFIDTHRV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 51/205 (25%)
cacng3aXP_021331621.1 PMP22_Claudin 13..202 CDD:328820 55/218 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.