DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng3b

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_693299.1 Gene:cacng3b / 564883 ZFINID:ZDB-GENE-090828-1 Length:309 Species:Danio rerio


Alignment Length:234 Identity:65/234 - (27%)
Similarity:98/234 - (41%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFT----EEKLPNANYNGTANFKALDDGAYIT 277
            |...:.|...|||.|.|..:.:::..|:....||::    ..|..|.|.....|.:.:       
Zfish     1 MLMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSNNENETSRKNEEVM------- 58

  Fly   278 KYTKSSLWILCT---TLPGLDADSYNCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFLAAG 338
              |.|.||..|.   |..|:      |.|||:|..:. |:.|      |..|.:.    ...|:.
Zfish    59 --THSGLWRTCCLEGTFRGV------CKKIDHFPEDADYEQD------AAEYLLR----AVRASS 105

  Fly   339 VFLVISF-IVFLIPTCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRP 396
            :|.::|. ::|:...|...:..|      ..||||.|:.:||..:||:|.|||....:.|.....
Zfish   106 IFPIMSVGLLFMGGLCVAASEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSK 170

  Fly   397 RSTLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
            :|        .|||.||:.....||:.|.||||.:.:||
Zfish   171 KS--------YSYGWSFYFGALSFIMAEMVGVLAVHMFI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 54/208 (26%)
cacng3bXP_693299.1 PMP22_Claudin 6..196 CDD:419754 61/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9896
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm24542
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.