DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and Tmem235

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001079004.1 Gene:Tmem235 / 546519 MGIID:3651706 Length:211 Species:Mus musculus


Alignment Length:195 Identity:46/195 - (23%)
Similarity:74/195 - (37%) Gaps:30/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAY--ITKYTKSSLWIL 287
            |.|...:.|.:|.|::.||:|...|...|               ..|.|..  :..::.|.||..
Mouse     7 LLLSAALGALLSFALLAAAVASDYWYILE---------------VADAGGLGGVQLFSHSGLWRT 56

  Fly   288 CTTLPGLDADSYNCVK-IDYFSNEGYQPDPH-DSTAAIPYTVTKSCPIFLAAGVFLVISFIVFLI 350
            |       ....:||. ||.|::.|.:..|. ....::..||....|:.|   |.:|..::..|:
Mouse    57 C-------EGQNSCVPLIDPFASAGLEVSPSVQHLLSLHRTVMVVLPLSL---VLIVCGWVCGLL 111

  Fly   351 PTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQSFFL 415
            .:.| |:.....:.|..|::.|.:.|.||..|||..........|.........:.:|:|.|..|
Mouse   112 SSLS-QSVPLLLATGCYFLLGGALTLAGLSIYISYSHLAFVEAARTYGVTHVQNVHISFGWSLAL 175

  Fly   416  415
            Mouse   176  175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 43/185 (23%)
Tmem235NP_001079004.1 Claudin_2 28..184 CDD:290614 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.