DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and Cacng3

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_062303.2 Gene:Cacng3 / 54376 MGIID:1859165 Length:315 Species:Mus musculus


Alignment Length:231 Identity:65/231 - (28%)
Similarity:98/231 - (42%) Gaps:42/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK--- 278
            |...:.|...|||.|.|..:.:::..|:....||::         .|....|:..|.....|   
Mouse     1 MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYS---------RGVCRTKSTSDNETSRKNEE 56

  Fly   279 -YTKSSLWILCTTLPGLDADSYNCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFLAAGVFL 341
             .|.|.||..| .|.|  |....|.|||:|..:. |:.|    ||.......:      |:.||.
Mouse    57 VMTHSGLWRTC-CLEG--AFRGVCKKIDHFPEDADYEQD----TAEYLLRAVR------ASSVFP 108

  Fly   342 VISF-IVFLIPTCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRST 399
            ::|. ::|....|...:..:      ..||||.|:.:||..:||:|.|||....:.|.:...:| 
Mouse   109 ILSVTLLFFGGLCVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKS- 172

  Fly   400 LQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
                   .|||.||:...|.||:.|.|||:.:.::|
Mouse   173 -------YSYGWSFYFGAFSFIIAEIVGVVAVHIYI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 56/205 (27%)
Cacng3NP_062303.2 PMP22_Claudin 6..196 CDD:419754 63/219 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..253
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10601
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm43441
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.