DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and stg-1

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001021976.1 Gene:stg-1 / 3564873 WormBaseID:WBGene00007670 Length:366 Species:Caenorhabditis elegans


Alignment Length:218 Identity:58/218 - (26%)
Similarity:102/218 - (46%) Gaps:35/218 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 AIVIAALA---------GPQWLFTEEKLPNANY----NGTANFKALDDGAYITK--YTKSSL--- 284
            |::.:|:|         ...||:|.|.|   .|    |.|.||   ||.:..|.  |.|::.   
 Worm    26 ALICSAMACGCNTLCSSTNHWLYTSEVL---RYFIFPNQTLNF---DDTSTATAPVYYKNATIGP 84

  Fly   285 WILCTTLPGLDADSYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFIVFL 349
            |:.|...|   ...::|..:.|.::|    :|.|:|.::..:|.::. :|:.||:.| ..|.:|:
 Worm    85 WLFCWADP---ITPFHCSTVYYLTDE----EPSDTTTSVQQSVRRAF-LFMLAGMIL-DGFGLFM 140

  Fly   350 IPTCSHQNNLY--YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQS 412
            ...|....|.|  ...:.:|.|.||:.....:|.|:|.:..|:|:|:...|.:...|..:|||.|
 Worm   141 AIICYCLKNPYASLLISSLLHINSGIANFSCIIVYMSAVSKEVGNKIHAASEMDDPLFYMSYGFS 205

  Fly   413 FFLFVFGFIVTEFVGVLNIFLFI 435
            |:.....|:.||...:.:|.:::
 Worm   206 FWCLKASFLFTELAALFSIVVYM 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 57/210 (27%)
stg-1NP_001021976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - oto18128
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.