DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and Cacng7

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_542426.1 Gene:Cacng7 / 140728 RGDID:628807 Length:275 Species:Rattus norvegicus


Alignment Length:219 Identity:67/219 - (30%)
Similarity:103/219 - (47%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEE--KLPNANYNGTANFK-ALDDGAYITKYTKSSLWI 286
            |.|::.|..:..:.:|..|::...||:.||  .||.   |.|...| ||..|          ||.
  Rat     9 LTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQ---NQTTEVKMALHAG----------LWR 60

  Fly   287 LCTTLPGLDADSYNCVKIDYFSNEGYQPDPH---DSTAAIPYTVTKSCPIFLAAGVFLVISFIVF 348
            :|..   ...:...||..:||    .:|:.:   ::|..|..||..:.| |....:|||  |..|
  Rat    61 VCFF---AGREKGRCVASEYF----LEPEINLVTENTENILKTVRTATP-FPMVSLFLV--FTAF 115

  Fly   349 LIPTCSH---QNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYG 410
            :|....|   |..:..|.:||.||:|||.:::||:.|||.:..|:.:  ||.|:.|  .....||
  Rat   116 VISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMN--RPSSSEQ--YFHYRYG 176

  Fly   411 QSFFLFVFGFIVTEFVGVLNIFLF 434
            .||......|::.|..||::::||
  Rat   177 WSFAFAASSFLLKEGAGVMSVYLF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 61/202 (30%)
Cacng7NP_542426.1 PMP22_Claudin 16..195 CDD:419754 61/205 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338192
Domainoid 1 1.000 59 1.000 Domainoid score I10376
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm45503
orthoMCL 1 0.900 - - OOG6_111421
Panther 1 1.100 - - LDO PTHR12107
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.