DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and Cacng5

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_542424.1 Gene:Cacng5 / 140726 RGDID:628805 Length:275 Species:Rattus norvegicus


Alignment Length:219 Identity:58/219 - (26%)
Similarity:98/219 - (44%) Gaps:18/219 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITKYTK 281
            |:|.....|.|::.|.|...:.::..|::...||:.||.:.......|....:|..|        
  Rat     1 MSTCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSG-------- 57

  Fly   282 SSLWILCTTLPGLDADSYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFI 346
              ||.:| .|.|  .:...|..|:|......|. ..:||..:...:..:.|..|.:..|:.|.||
  Rat    58 --LWRVC-FLAG--EERGRCFTIEYVMPMNSQM-TSESTVNVLKMIRSATPFPLVSLFFMFIGFI 116

  Fly   347 VFLIPTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQ 411
            :..|........:..|.:||.||:|||.:::||:.|||.:..|:.::.:...|    .....||.
  Rat   117 LSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET----YFNYKYGW 177

  Fly   412 SFFLFVFGFIVTEFVGVLNIFLFI 435
            ||......|::||..||::::||:
  Rat   178 SFAFAAISFLLTESAGVMSVYLFM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 49/193 (25%)
Cacng5NP_542424.1 PMP22_Claudin 18..195 CDD:419754 49/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338190
Domainoid 1 1.000 59 1.000 Domainoid score I10376
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm45503
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.