DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and Cacng4

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_542423.1 Gene:Cacng4 / 140725 RGDID:628804 Length:327 Species:Rattus norvegicus


Alignment Length:234 Identity:69/234 - (29%)
Similarity:109/234 - (46%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK--- 278
            |...:.|...|:|...|..:.:::..|:....||::...:    .||| |. .:|||....:   
  Rat     1 MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHI----CNGT-NL-TMDDGPPPRRARG 59

  Fly   279 -YTKSSLWILCTTLPGLDADSY--NCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFLAAGV 339
             .|.|.||.:| .:.|:    |  :|.:|::|..:. |.   |||:..:       ..|..|:.|
  Rat    60 DLTHSGLWRVC-CIEGI----YKGHCFRINHFPEDNDYD---HDSSEYL-------LRIVRASSV 109

  Fly   340 FLVISFIVFLI-PTC-------SHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRP 396
            |.::|.|:.|: ..|       |.:||: ..||||||:.:||..:||:|.|||   :..|.....
  Rat   110 FPILSTILLLLGGLCIGAGRIYSRKNNI-VLSAGILFVAAGLSNIIGIIVYIS---SNTGDPSDK 170

  Fly   397 RSTLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
            |.  :......:||.||:.....|||.|.||||.:.::|
  Rat   171 RD--EDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 61/208 (29%)
Cacng4NP_542423.1 PMP22_Claudin 6..202 CDD:419754 66/222 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..262
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338191
Domainoid 1 1.000 59 1.000 Domainoid score I10376
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm45503
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.