DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and CACNG2

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_006069.1 Gene:CACNG2 / 10369 HGNCID:1406 Length:323 Species:Homo sapiens


Alignment Length:233 Identity:63/233 - (27%)
Similarity:96/233 - (41%) Gaps:55/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK----YTKSS 283
            |...|:|.|.|..:.:::..|:....||::         .|....|::.:.....|    .|.|.
Human     7 GVQMLLTTVGAFAAFSLMTIAVGTDYWLYS---------RGVCKTKSVSENETSKKNEEVMTHSG 62

  Fly   284 LWILCT---TLPGLDADSYNCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFL----AAGVF 340
            ||..|.   ...||      |.:||:|..:. |:.|              :...||    |:.:|
Human    63 LWRTCCLEGNFKGL------CKQIDHFPEDADYEAD--------------TAEYFLRAVRASSIF 107

  Fly   341 LVISFI-VFLIPTCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRS 398
            .::|.| :|:...|...:..|      ..||||.|:.:||..:||:|.|||   |..|...:..|
Human   108 PILSVILLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYIS---ANAGDPSKSDS 169

  Fly   399 TLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFIN 436
            ...    ..|||.||:.....||:.|.||||.:.:||:
Human   170 KKN----SYSYGWSFYFGALSFIIAEMVGVLAVHMFID 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 54/212 (25%)
CACNG2NP_006069.1 PMP22_Claudin 6..197 CDD:395662 60/225 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10855
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm41386
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.