DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng4

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_031750551.1 Gene:cacng4 / 100486554 XenbaseID:XB-GENE-1014199 Length:328 Species:Xenopus tropicalis


Alignment Length:229 Identity:70/229 - (30%)
Similarity:105/229 - (45%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITKYTK-----S 282
            |...|:..|.|..:.:::..|:....||::...:    .||| |. ..||.....|.||     |
 Frog     7 GVQMLLATVGAFAAFSLMSIAIGTDYWLYSRAHI----CNGT-NI-TQDDAQAQPKKTKGDLTHS 65

  Fly   283 SLWILCTTLPGLDADSY--NCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVIS 344
            .||.:| .:.||    |  ||.:|::|..:. |.   |||:..:       ..|..|:.||.::|
 Frog    66 GLWRIC-CIEGL----YKGNCFRINHFPEDNDYD---HDSSEYL-------LRIVRASSVFPILS 115

  Fly   345 FIVFLI-PTC-------SHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQ 401
            .|:.|: ..|       |.:||: ..||||||:.:||..:||:|.|||....:...|.......|
 Frog   116 AILLLLGGLCIGAGRLYSRRNNI-ILSAGILFVAAGLSNIIGIIVYISSNAGDPSDKKDEDKKNQ 179

  Fly   402 PALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
                 .:||.||:.....|||.|.:|||.:.::|
 Frog   180 -----YNYGWSFYFGALSFIVAETIGVLAVNIYI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 63/209 (30%)
cacng4XP_031750551.1 PMP22_Claudin 6..203 CDD:419754 68/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10462
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm48588
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.