DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and tmem235b

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_001919554.1 Gene:tmem235b / 100150722 ZFINID:ZDB-GENE-130603-43 Length:200 Species:Danio rerio


Alignment Length:225 Identity:46/225 - (20%)
Similarity:80/225 - (35%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITKYTKSSLWIL 287
            |::.:...:...:|.:.:..|:....|...|::..|......:|               |.||  
Zfish     6 GFVVVCGGLTGVLSFSCLALAIGTEYWYIIEDQRTNHTNPERSN---------------SGLW-- 53

  Fly   288 CTTLPGLDAD-SYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFIVFLIP 351
                 |:..| ..|.....|..:|......|...|.:       .|:.|   |.||...|..|:.
Zfish    54 -----GVTEDEKSNSEDTGYSESERQMEIMHCVIAIL-------LPLSL---VMLVFGGICGLVS 103

  Fly   352 TCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQSFFLF 416
            :.:....|...||. .|::..|:.|.|:..||...:..:....|.....|.|.:..|:|.|..:.
Zfish   104 SLARSRALLIGSAS-YFLLCSLLTLSGVSLYIRYSQKALEETERRMGREQMAQVHTSFGWSMGMA 167

  Fly   417 VFGFIVTEFVGVLNIFLFINLQEVSYYSVS 446
            ...|::....|:| :.|.:.|..::.|..|
Zfish   168 WISFLLEVMTGLL-LLLAVKLVPLTQYEDS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 40/194 (21%)
tmem235bXP_001919554.1 PMP22_Claudin 17..178 CDD:304458 39/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.