DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and tmem114

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_017210262.1 Gene:tmem114 / 100150208 -ID:- Length:207 Species:Danio rerio


Alignment Length:67 Identity:17/67 - (25%)
Similarity:31/67 - (46%) Gaps:11/67 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 AGILFIVSGLVMLIGLI---AYISILKAEIGSKLRP------RSTLQPALIKVSYGQSFFLFVFG 419
            |.:|.:::|:::|.|.:   |.|.:..|...:..|.      ..|||.  |::.:|.|..|....
Zfish   117 AYVLLLLTGVLLLFGAVLSLAGICVYMAYSAAAFREAVDISGHKTLQD--IEIYFGWSLILASVS 179

  Fly   420 FI 421
            |:
Zfish   180 FV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 17/67 (25%)
tmem114XP_017210262.1 PMP22_Claudin 17..191 CDD:304458 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.