powered by:
Protein Alignment stg1 and tmem114
DIOPT Version :9
Sequence 1: | NP_001027082.1 |
Gene: | stg1 / 318064 |
FlyBaseID: | FBgn0064123 |
Length: | 447 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017210262.1 |
Gene: | tmem114 / 100150208 |
-ID: | - |
Length: | 207 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 17/67 - (25%) |
Similarity: | 31/67 - (46%) |
Gaps: | 11/67 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 364 AGILFIVSGLVMLIGLI---AYISILKAEIGSKLRP------RSTLQPALIKVSYGQSFFLFVFG 419
|.:|.:::|:::|.|.: |.|.:..|...:..|. ..|||. |::.:|.|..|....
Zfish 117 AYVLLLLTGVLLLFGAVLSLAGICVYMAYSAAAFREAVDISGHKTLQD--IEIYFGWSLILASVS 179
Fly 420 FI 421
|:
Zfish 180 FV 181
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.870 |
|
Return to query results.
Submit another query.