DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng8b

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_001342922.4 Gene:cacng8b / 100003329 ZFINID:ZDB-GENE-100921-72 Length:422 Species:Danio rerio


Alignment Length:220 Identity:64/220 - (29%)
Similarity:96/220 - (43%) Gaps:32/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 LITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTA----NFKALDDGAYITKYTKSSLWIL 287
            |:|.|.|..|..::..|:....||::...:.|:..|.|.    |....|.||    .|.|.||.:
Zfish    10 LLTIVGAFASFGLMTVAIGTDYWLYSRALICNSTANNTQEDPHNKDKKDPGA----LTHSGLWRI 70

  Fly   288 CTTLPGLDADSYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFIVFLI-P 351
            | .|.|:....  |.:|::|..:.  ...||....:...|.       |:.:|.::|.|:.|: .
Zfish    71 C-CLEGVKRGV--CSQINHFPEDA--DFDHDGAEYVLRVVR-------ASNIFPILSAILLLMGG 123

  Fly   352 TCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYG 410
            .|...:..|      ...|||||:.:||..:||:|.|||....:|..|.......|     .|||
Zfish   124 VCIAASRFYKSKRNIVLGAGILFVAAGLSNIIGVIVYISAALGDISPKKDEDKKWQ-----YSYG 183

  Fly   411 QSFFLFVFGFIVTEFVGVLNIFLFI 435
            .||:.....||:.|.||||.:.::|
Zfish   184 WSFYFGGLSFILAEMVGVLAVNIYI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 57/204 (28%)
cacng8bXP_001342922.4 PMP22_Claudin 5..203 CDD:328820 62/213 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577604
Domainoid 1 1.000 66 1.000 Domainoid score I9896
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm24542
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.