DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng7b

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_001342879.2 Gene:cacng7b / 100003278 ZFINID:ZDB-GENE-100921-51 Length:346 Species:Danio rerio


Alignment Length:223 Identity:63/223 - (28%)
Similarity:108/223 - (48%) Gaps:26/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFK-ALDDGAYITKYT 280
            |::.:...|.|::.|..:..:.:|..|:|...||..||.:. ...|.|.:.| ||..|       
Zfish     1 MSSCSSRALTLLSTVFGACGLLLVGVAVATDYWLLMEEGIV-LQQNQTVDVKMALHSG------- 57

  Fly   281 KSSLWILCTTLPGLDADSYNCVKIDYFSNEGYQPD---PHDSTAAIPYTVTKSCPIFLAAGVFLV 342
               ||.:| .:.|  .:...||..:||:    :|:   ..::||.|...|..:.|..:.:.:|:.
Zfish    58 ---LWRVC-FIAG--TEKGRCVASEYFT----EPEIEITTENTANILKMVRTATPFPMVSLLFVF 112

  Fly   343 ISFIVFLIPTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKV 407
            .:||:..:.....|..:..|.:||.||:|||.:::||:.|||.:..|:.:  |||...|  ....
Zfish   113 TAFIISNVGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMN--RPREPEQ--FFNY 173

  Fly   408 SYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
            .||.||......|::.|..||::::||:
Zfish   174 RYGWSFAFAASSFLLKEGAGVMSVYLFM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 56/197 (28%)
cacng7bXP_001342879.2 PMP22_Claudin 18..195 CDD:304458 56/198 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577605
Domainoid 1 1.000 66 1.000 Domainoid score I9896
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm24542
orthoMCL 1 0.900 - - OOG6_111421
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.