DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32507 and GPRASP2

DIOPT Version :10

Sequence 1:NP_728363.1 Gene:CG32507 / 318060 FlyBaseID:FBgn0052507 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_612446.1 Gene:GPRASP2 / 114928 HGNCID:25169 Length:838 Species:Homo sapiens


Alignment Length:159 Identity:41/159 - (25%)
Similarity:59/159 - (37%) Gaps:32/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QPYNSVQDEATPGEIFPRIVEVFVNGEYTAEADPNPEVEVVTEVDPLAEVEDWAKADPNTEVEVL 90
            :|....:.|...||      ||.        |.|..|.:|...|.|....:....|.|.||.:.:
Human     7 EPSAQAKPEKKAGE------EVI--------AGPERENDVPLVVRPKVRTQATTGARPKTETKSV 57

  Fly    91 AEADPNTEFEVFAEAYPKIEDEIVVMEEADFKTYTKDDDMADADPMTEVEVMAVADPNTEVEVLV 155
            ..|.|.||.:..:.|.||.|.::                |..|.|.||.:.:..|.|.|:...:.
Human    58 PAARPKTEAQAMSGARPKTEVQV----------------MGGARPKTEAQGITGARPKTDARAVG 106

  Fly   156 EANRKAEFEVFAEADPKVEDEIEVMEQAE 184
            .|..|.:.:....|.||  ||.:...|:|
Human   107 GARSKTDAKAIPGARPK--DEAQAWAQSE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32507NP_728363.1 None
GPRASP2NP_612446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..122 35/144 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..292
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..552
Arm_2 593..813 CDD:461447
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.