DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ogg1 and OGG1

DIOPT Version :9

Sequence 1:NP_572499.2 Gene:Ogg1 / 31806 FlyBaseID:FBgn0027864 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_058214.1 Gene:OGG1 / 4968 HGNCID:8125 Length:424 Species:Homo sapiens


Alignment Length:291 Identity:105/291 - (36%)
Similarity:159/291 - (54%) Gaps:14/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ECDLERTLLGGQSFRWRSICDGNRTKYGGVVFNTYWVLQQEESFITYEAY-GTSSPLA--TKDYS 94
            |..|:..|..|||||||   :.:...:.||:.:..|.|.|.|..:....| |..|..:  |.|..
Human    32 ELRLDLVLPSGQSFRWR---EQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKSQASRPTPDEL 93

  Fly    95 SLISDYLRVDFDLKVNQKDWLSKDDNFVKFLSK--PVRLLSQEPFENIFSFLCSQNNNIKRISSM 157
            ..:..|.::|..|......|.|.|.:|.:...|  .||||.|:|.|.:|||:||.||||.||:.|
Human    94 EAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGM 158

  Fly   158 IEWFCATFGTKIGHFNGADAYTFPTINRFHDIPCEDLNAQLRAAKFGYRAKFIAQTLQEI-QKKG 221
            :|..|..||.::...:....:.||::..   :...::.|.||....||||::::.:.:.| :::|
Human   159 VERLCQAFGPRLIQLDDVTYHGFPSLQA---LAGPEVEAHLRKLGLGYRARYVSASARAILEEQG 220

  Fly   222 GQNWFISLKSMPFEKAREELTLLPGIGYKVADCICLMSMGHLESVPVDIHIYRIAQNYYLPHLTG 286
            |..|...|:...:|:|.:.|.:|||:|.|||||||||::...::||||:|::.|||..|..|.|.
Human   221 GLAWLQQLRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTT 285

  Fly   287 Q--KNVTKKIYEEVSKHFQKLHGKYAGWAQA 315
            .  |..:.:..:|:...|:.|.|.|||||||
Human   286 SQAKGPSPQTNKELGNFFRSLWGPYAGWAQA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ogg1NP_572499.2 OGG_N 26..140 CDD:285211 36/111 (32%)
ogg 33..324 CDD:211589 105/291 (36%)
ENDO3c 137..318 CDD:238013 70/182 (38%)
OGG1NP_058214.1 ogg 11..322 CDD:211589 105/291 (36%)
OGG_N 25..141 CDD:285211 36/111 (32%)
ENDO3c 139..319 CDD:238013 70/181 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160042
Domainoid 1 1.000 115 1.000 Domainoid score I6041
eggNOG 1 0.900 - - E1_COG0122
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1909
Inparanoid 1 1.050 195 1.000 Inparanoid score I3830
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55194
OrthoDB 1 1.010 - - D1079482at2759
OrthoFinder 1 1.000 - - FOG0005614
OrthoInspector 1 1.000 - - oto89259
orthoMCL 1 0.900 - - OOG6_102483
Panther 1 1.100 - - LDO PTHR10242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2212
SonicParanoid 1 1.000 - - X4591
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.