DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and TBC1D5

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001127853.1 Gene:TBC1D5 / 9779 HGNCID:19166 Length:817 Species:Homo sapiens


Alignment Length:248 Identity:58/248 - (23%)
Similarity:102/248 - (41%) Gaps:57/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   922 SPASSNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDK-LRNVISTYVWEHLDVGYM 985
            :|.|.:.|...::..:...|. ..||:||:|......:|..||:.| |.:|:..|..|:..:.|.
Human   140 NPLSQDEGSLWNKFFQDKELR-SMIEQDVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYK 203

  Fly   986 QGMCDLVAPLL------------------------VIFDDESL---SYSCFCKLMER---MIENF 1020
            |||.:|:||::                        .:.:.|.|   :|:.|.:|||.   ....|
Human   204 QGMHELLAPIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQLMETAEPWFSTF 268

  Fly  1021 PSGG-------AMDMHFANMRSL---IQILD--SEMYDLMDSNGD---YTHF--------YFCYR 1062
            ...|       ...:.||..:.|   |.|:.  :::.|.:....|   |.|.        .:..|
Human   269 EHDGQKGKETLMTPIPFARPQDLGPTIAIVTKVNQIQDHLLKKHDIELYMHLNRLEIAPQIYGLR 333

  Fly  1063 WFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNS 1115
            |..|.|.||....|:...|:.:: |..::.| .|.::.:|:|...||.::|::
Human   334 WVRLLFGREFPLQDLLVVWDALF-ADGLSLG-LVDYIFVAMLLYIRDALISSN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 50/217 (23%)
TBC1D5NP_001127853.1 TBC 79..381 CDD:214540 57/243 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.