Sequence 1: | NP_001285494.1 | Gene: | tbc / 318059 | FlyBaseID: | FBgn0052506 | Length: | 1155 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001127853.1 | Gene: | TBC1D5 / 9779 | HGNCID: | 19166 | Length: | 817 | Species: | Homo sapiens |
Alignment Length: | 248 | Identity: | 58/248 - (23%) |
---|---|---|---|
Similarity: | 102/248 - (41%) | Gaps: | 57/248 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 922 SPASSNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDK-LRNVISTYVWEHLDVGYM 985
Fly 986 QGMCDLVAPLL------------------------VIFDDESL---SYSCFCKLMER---MIENF 1020
Fly 1021 PSGG-------AMDMHFANMRSL---IQILD--SEMYDLMDSNGD---YTHF--------YFCYR 1062
Fly 1063 WFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNS 1115 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tbc | NP_001285494.1 | RUN | 45..218 | CDD:280855 | |
PH_RUTBC | 292..466 | CDD:275431 | |||
TBC | 923..1087 | CDD:214540 | 50/217 (23%) | ||
TBC1D5 | NP_001127853.1 | TBC | 79..381 | CDD:214540 | 57/243 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |