DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and TBC1D10A

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001191169.1 Gene:TBC1D10A / 83874 HGNCID:23609 Length:515 Species:Homo sapiens


Alignment Length:339 Identity:58/339 - (17%)
Similarity:101/339 - (29%) Gaps:135/339 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   879 TNWERSPKA-AEGDQMSPLEEQAGESGGAGVNMDALQQPKSACASPASSNGGVYSSELLEQFGL- 941
            :|.|..|:| |.|:.:|...|...: |......|.|    |:..|.:.:||  ::...:::||. 
Human     4 SNGENGPRAPAAGESLSGTRESLAQ-GPDAATTDEL----SSLGSDSEANG--FAERRIDKFGFI 61

  Fly   942 ------------NLHRIEK---DVQRCDRNYWYFANENLDK------------------------ 967
                        .|||:|:   :|.|...:.|.....|.||                        
Human    62 VGSQGAEGAPCPLLHRLEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGR 126

  Fly   968 -----------------------------------------------------------LRNVIS 973
                                                                       |..|:.
Human   127 AWQYLSGGKVKLQQNPGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLFRVLK 191

  Fly   974 TYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQ 1038
            .|.....:.||.|....:.|.||:....|. ::.|..::.|:.:..:         ::.....||
Human   192 AYTLYRPEEGYCQAQAPIAAVLLMHMPAEQ-AFWCLVQICEKYLPGY---------YSEKLEAIQ 246

  Fly  1039 ILDSE-MYDLMDSNGDYTH----------FYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIAS 1092
             ||.| ::.|:.......|          ..:...||:..|.|.|.:..|...|::.:     ..
Human   247 -LDGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFSRTLPWSSVLRVWDMFF-----CE 305

  Fly  1093 GHFVLF-LALALLE 1105
            |..::| :.|.||:
Human   306 GVKIIFRVGLVLLK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 40/273 (15%)
TBC1D10ANP_001191169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 13/46 (28%)
TBC 117..320 CDD:214540 31/219 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..515
ZipA <403..>502 CDD:331990
Binding to the PDZ domain of EBP50 512..515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.