Sequence 1: | NP_001285494.1 | Gene: | tbc / 318059 | FlyBaseID: | FBgn0052506 | Length: | 1155 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001191169.1 | Gene: | TBC1D10A / 83874 | HGNCID: | 23609 | Length: | 515 | Species: | Homo sapiens |
Alignment Length: | 339 | Identity: | 58/339 - (17%) |
---|---|---|---|
Similarity: | 101/339 - (29%) | Gaps: | 135/339 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 879 TNWERSPKA-AEGDQMSPLEEQAGESGGAGVNMDALQQPKSACASPASSNGGVYSSELLEQFGL- 941
Fly 942 ------------NLHRIEK---DVQRCDRNYWYFANENLDK------------------------ 967
Fly 968 -----------------------------------------------------------LRNVIS 973
Fly 974 TYVWEHLDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGGAMDMHFANMRSLIQ 1038
Fly 1039 ILDSE-MYDLMDSNGDYTH----------FYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIAS 1092
Fly 1093 GHFVLF-LALALLE 1105 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tbc | NP_001285494.1 | RUN | 45..218 | CDD:280855 | |
PH_RUTBC | 292..466 | CDD:275431 | |||
TBC | 923..1087 | CDD:214540 | 40/273 (15%) | ||
TBC1D10A | NP_001191169.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..46 | 13/46 (28%) | |
TBC | 117..320 | CDD:214540 | 31/219 (14%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 403..515 | ||||
ZipA | <403..>502 | CDD:331990 | |||
Binding to the PDZ domain of EBP50 | 512..515 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |