DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and AT4G28550

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_194584.3 Gene:AT4G28550 / 828973 AraportID:AT4G28550 Length:424 Species:Arabidopsis thaliana


Alignment Length:250 Identity:61/250 - (24%)
Similarity:114/250 - (45%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   938 QFGLNLHRIEKDVQRCDRNYWYFANE-NLDKLRNVISTYVWEHLDVGYMQGMCDLVAPLLVIFDD 1001
            |:.|.|.:|..||.|.||...::.:| |..:|.:::|.|.|.:.|:||:|||.|:.:|::::.:|
plant   162 QWMLVLSQIGLDVVRTDRYLCFYESESNQARLWDILSIYTWLNPDIGYVQGMNDICSPMIILLED 226

  Fly  1002 ESLSYSCFCKLMERMIENF---PSGGAMDMHFANMRSLIQILDSEMYD-LMDSNGDYTHFYFCYR 1062
            |:.::.||.:.|.|:.|||   .:...:......:..:|:.:|..::. |.|.:|.  .:.|..|
plant   227 EADAFWCFERAMRRLRENFRTTATSMGVQTQLGMLSQVIKTVDPRLHQHLEDLDGG--EYLFAIR 289

  Fly  1063 WFLLDFKRELVYDDVFATWEVIWA-----------------------------------AKHIAS 1092
            ..::.|:||..:.|....||::||                                   .|:|.|
plant   290 MLMVLFRREFSFLDALYLWELMWAMEYNPNKFASYEEPQNMNNSSGQDPRLLKQYGKFERKYIKS 354

  Fly  1093 GH------FVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAERHNAQSVLQLA 1141
            |.      ..:|:..::|||....:|..:....||::....:|...:|:...:.|
plant   355 GQNEQHNTLAVFVVASVLETKNKRLLKEAKGLDDVVQILGGIAGNLDARKACKEA 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 47/188 (25%)
AT4G28550NP_194584.3 RabGAP-TBC 163..313 CDD:366170 44/151 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.