DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and AT4G27100

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_194440.2 Gene:AT4G27100 / 828818 AraportID:AT4G27100 Length:436 Species:Arabidopsis thaliana


Alignment Length:264 Identity:71/264 - (26%)
Similarity:121/264 - (45%) Gaps:64/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   925 SSNGGVYSSEL---------LEQFGLNLHRIEKDVQRCDRN-YWYFANENLDKLRNVISTYVWEH 979
            :|||.|:..||         :.|:.|.||:|..||.|.||. .:|...|||.||.:::|.|.|..
plant   146 NSNGSVFFKELTSRGPLDKKIIQWLLTLHQIGLDVNRTDRALVFYEKKENLSKLWDILSVYAWID 210

  Fly   980 LDVGYMQGMCDLVAPLLVIFDDESLSYSCFCKLMERMIENFPSGG---AMDMHFANMRSLIQILD 1041
            .||||.|||.||.:|::::.:||:.::.||.:||.|:..||.|.|   .::....::.|:.|::|
plant   211 NDVGYCQGMSDLCSPMIILLEDEADAFWCFERLMRRLRGNFRSTGRSVGVEAQLTHLSSITQVVD 275

  Fly  1042 SEMYDLMD--SNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFV-------- 1096
            .:::..:|  ..|||   .|..|..::.|:||..:.|....||::||.::.....:|        
plant   276 PKLHQHLDKLGGGDY---LFAIRMLMVQFRREFSFCDSLYLWEMMWALEYDPDLFYVYEAHQCGN 337

  Fly  1097 --------------------------------------LFLALALLETYRDIILSNSMDFTDVIK 1123
                                                  :||..::|:.....:::.:....||:|
plant   338 EKTEGLKGKPKSIKQCGKYERQNMRNGGKSAEGPLPISVFLVASVLKDKSYKLMTEARGLDDVVK 402

  Fly  1124 FFNE 1127
            ..|:
plant   403 ILND 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 62/176 (35%)
AT4G27100NP_194440.2 RabGAP-TBC 174..330 CDD:278964 54/158 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.