DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbc and Tbc1d5

DIOPT Version :9

Sequence 1:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster
Sequence 2:NP_001272920.1 Gene:Tbc1d5 / 72238 MGIID:1919488 Length:837 Species:Mus musculus


Alignment Length:264 Identity:59/264 - (22%)
Similarity:103/264 - (39%) Gaps:64/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   913 LQQPKSACA-------SPASSNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDK-LR 969
            :..|:.|..       :|.|.:.|...::..:...|. ..||:||:|......:|..||:.| |.
Mouse   124 ITNPRKAAGQQDLMINNPLSQDEGSLWNKFFQDKELR-SMIEQDVKRTFPEMQFFQQENVRKILT 187

  Fly   970 NVISTYVWEHLDVGYMQGMCDLVAPLL------------------------VIFDDESL---SYS 1007
            :|:..|..|:..:.|.|||.:|:||::                        .:.:.|.|   :|:
Mouse   188 DVLFCYARENEQLLYKQGMHELLAPIIFTLHCDHQAFLHASESAQPSEEMKTLLNPEYLEHDAYA 252

  Fly  1008 CFCKLMER---MIENFPSGG-------AMDMHFANMRSL---IQILD--SEMYDLMDSNGD---Y 1054
            .|.:|||.   ....|...|       ...:.||..:.|   :.|:.  :::.|.:....|   |
Mouse   253 MFSQLMETAEPWFSTFEHDGQKGKETLMAPIPFARPQDLGPTVAIVTKVNQIQDHLLKKHDIELY 317

  Fly  1055 THF--------YFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDII 1111
            .|.        .:..||..|.|.||....|:...|:.::|.....|  .|.::..|:|...||.:
Mouse   318 MHLNRLEIAPQIYGLRWVRLLFGREFPLQDLLVVWDALFADSLNLS--LVDYVFTAMLLYIRDAL 380

  Fly  1112 LSNS 1115
            :|::
Mouse   381 ISSN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 49/217 (23%)
Tbc1d5NP_001272920.1 TBC 79..381 CDD:214540 58/259 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.